|
No: |
04890000032 |
|
Sequence: |
MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYE |
|
Amount: |
25ug/peptide |
|
Purity: |
>85% (HPLC-MS) |
|
Appearance: |
white to off-white powder |
|
Remark: |
Every peptide in the peptide pools contains 15 amino-acid peptides spanning the complete amino acid sequence of the indicated protein.The peptides of this product are supplied as freeze-dried trifluoroacetate salts. For research use only. |
|
Storage conditions: |
Store at - 20°C |


Contact Us